PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_00A8A2030.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 227aa    MW: 24455.1 Da    PI: 5.3041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_00A8A2030.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-1172118551
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                             r rr   NReA r++R++Kka  + Lee+vk+L a N++L+ +l+ 
  Traes_1AL_00A8A2030.2  72 ARPRRPLGNREAVRKYREKKKAHAAFLEEEVKQLRAANQQLQRRLQG 118
                            57789999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-1766136No hitNo description
SMARTSM003381.9E-1167135IPR004827Basic-leucine zipper domain
PfamPF077166.9E-1569123IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.25570117IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.94E-873118No hitNo description
CDDcd146862.18E-1375127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042538Biological Processhyperosmotic salinity response
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MDDGVDLPSQ FLFPHPEMPG AFSDLLGDAA ATCTHTHTCN PPGPSAATHT HTCLHTHTHQ  60
LFAAGSEDDD AARPRRPLGN REAVRKYREK KKAHAAFLEE EVKQLRAANQ QLQRRLQGHA  120
TLEAEVARLR GLLFDVRAKI DAEAAGAFPF QKQCSVGSVA CADPTLCFNN GNSEVGGACW  180
EDSSGPAAAD YRFDEDGNGN GGASREIDAP EQPVRSMDVV ELCCFPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3719680.0AK371968.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2144D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566090.11e-102PREDICTED: uncharacterized protein LOC100823248
SwissprotQ8GTS22e-50BZP23_ARATH; Basic leucine zipper 23
TrEMBLW4ZLJ31e-168W4ZLJ3_WHEAT; Uncharacterized protein
STRINGMLOC_13410.11e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-24bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]